PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 313aa    MW: 33885.5 Da    PI: 5.8194
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016855genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd++l  ++ q G g W++ ++  g+ R++k+c++rw +yl
      Lus10016855 14 KGRWTAEEDQILTAYILQNGEGKWRSLPKDAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding538e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++E+e +v++++ lG++ W++Ia+ ++ gRt++++k++w+++l
      Lus10016855  67 RGNITKDEEETIVKLHNALGNR-WSLIAAQLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.595961IPR017930Myb domain
SuperFamilySSF466899.36E-2811108IPR009057Homeodomain-like
SMARTSM007178.5E-111363IPR001005SANT/Myb domain
PfamPF002497.3E-131461IPR001005SANT/Myb domain
CDDcd001671.24E-71661No hitNo description
PROSITE profilePS5129424.88262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-2565116IPR009057Homeodomain-like
SMARTSM007177.8E-1666114IPR001005SANT/Myb domain
PfamPF002499.2E-1567112IPR001005SANT/Myb domain
CDDcd001674.54E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDQILTAYIL QNGEGKWRSL PKDAGLLRCG KSCRLRWINY  60
LRADLKRGNI TKDEEETIVK LHNALGNRWS LIAAQLPGRT DNEIKNYWNS HLSRKIYCFP  120
SRRSPAAGHS SASSAASSSS SANSTTTSID IIAPPPAAAS RGKSRKSSAN KKKQPAEKSK  180
DGKSEASLSG ISANSAEQNS GDDGAAPTAA GGGGELMSLD GVGMKVVGDE DVLEPYEWLD  240
SEINRLKSSL IPTEVEDSAV KRNDDMVVEN KGGESNGNKC GGGGEEEWLD WDQIDNIQWD  300
HEVDYNNSFP WL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015574695.11e-82PREDICTED: myb-related protein Myb4
SwissprotO222644e-71MYB12_ARATH; Transcription factor MYB12
TrEMBLB9HWW81e-80B9HWW8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15090.13e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.13e-72myb domain protein 111